Passa al contenuto
Merck
Tutte le immagini(1)

Documenti

AV50093

Sigma-Aldrich

Anti-PIGO antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-DKFZp434M222, Anti-FLJ00135, Anti-MGC20536, Anti-MGC3079, Anti-Phosphatidylinositol glycan anchor biosynthesis, class O, Anti-RP11-182N22.4

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

74 kDa

Reattività contro le specie

guinea pig, human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PIGO(84720)

Descrizione generale

The previously assigned protein identifier B1AML3 has been merged into Q8TEQ8. Full details can be found on the UniProt database.

Immunogeno

Synthetic peptide directed towards the N terminal region of human PIGO

Applicazioni

Anti-PIGO antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Azioni biochim/fisiol

Phosphatidylinositol glycan anchor biosynthesis, class O (PIGO; HPMRS2) protein is involved in the biosynthesis of glycosylphosphatidylinositol anchor that is present on blood cells and anchors the cell surface proteins. Mutations in PIGO gene results in hyperphosphatasia with mental retardation (HPMRS).

Sequenza

Synthetic peptide located within the following region: LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

12 - Non Combustible Liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

T Kinoshita et al.
Current opinion in chemical biology, 4(6), 632-638 (2000-12-05)
The pathway for glycosylphosphatidylinositol-anchor biosynthesis consists of at least 10 reaction steps. Many of the genes encoding the enzymes and regulators involved in this pathway have been recently cloned and their products characterised. These studies have revealed the common and
Peter M Krawitz et al.
American journal of human genetics, 91(1), 146-151 (2012-06-12)
Hyperphosphatasia with mental retardation syndrome (HPMRS), an autosomal-recessive form of intellectual disability characterized by facial dysmorphism, seizures, brachytelephalangy, and persistent elevated serum alkaline phosphatase (hyperphosphatasia), was recently shown to be caused by mutations in PIGV, a member of the glycosylphosphatidylinositol

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.