WH0057492M1

Monoclonal Anti-ARID1B antibody produced in mouse

clone 2D2, purified immunoglobulin, buffered aqueous solution

• Szinonimák: Anti-6A35, Anti-AT rich interactive domain 1B (SWI1-like), Anti-BAF250b, Anti-DAN15, Anti-ELD/OSA1, Anti-KIAA1235, Anti-p250R
• UNSPSC kód: 12352203
• NACRES: NA.41

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: 2D2, monoclonal
• form: buffered aqueous solution
• faj reaktivitás: human
• technika/technikák: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• izotípus: IgG2bκ
• GenBank elérési szám: NM_017519
• UniProt elérési szám: Q8NFD5
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... ARID1B(57492)

Leírás

Általános leírás

AT-rich interaction domain 1B (ARID1B) is a member of SWItch/sucrose nonfermentable (SWI/SNF) chromatin remodelling complex. ARID1B gene is located on human chromosome 6q25.3.

Immunogen

ARID1B (NP_059989, 1364 a.a. ~ 1460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR

Biokémiai/fiziológiai hatások

AT-rich interaction domain 1B (ARID1B) is involved in the regulation of transcription and multiple downstream cellular processes. ARID1B acts as a coactivator of cell cycle genes. ARID1B acts as tumor suppressor in pancreatic cancer cell line. Mutations in ARID1B might be associated with Coffin-Siris syndrome (CSS).

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Jogi információk

GenBank is a registered trademark of United States Department of Health and Human Services

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: nwg
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable
• Egyéni védőeszköz: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)