SAB5702128

Anti-Mitofusin 2 Antibody, clone 4H10F8, Rabbit Monoclonal

• Szinonimák: CMT2A,CMT2A2,CMT2A2A,CMT2A2B,CPRP1,HMSN6A,HSG,MARF,MFN2,Mitofusin 2
• UNSPSC kód: 12352203
• NACRES: NA.46
• klón: 4H10F8, monoclonal
• application: WB
• faj reaktivitás: rat, rat, human
• technika/technikák: western blot: 1:500 - 1:2000

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• material: colorless
• klón: 4H10F8, monoclonal
• Forma: liquid
• molekulatömeg: 80 kDa
• faj reaktivitás: rat, rat, human
• koncentráció: 2 mg/mL
• technika/technikák: western blot: 1:500 - 1:2000
• szín: colorless
• izotípus: IgG
• immunogén szekvencia: MSLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDTYRNAELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVA
• UniProt elérési szám: O95140
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... MFN2(9927)

Leírás

Általános leírás

This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]

Immunogén

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Mitofusin 2 (O95140).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Alkalmazás

WB

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1