SAB2109057

Anti-LBR antibody produced in rabbit

affinity isolated antibody

• Szinonimák: DHCR14B, LMN2R, MGC9041, PHA
• UNSPSC kód: 12352203
• NACRES: NA.43

Tulajdonságok

• biológiai forrás: rabbit
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• form: buffered aqueous solution
• molekulatömeg: 71 kDa
• faj reaktivitás (homológia által előrejelzett): mouse, pig, horse, human, yeast, canine, zebrafish, guinea pig, bovine, rabbit
• koncentráció: 0.5 mg/mL
• technika/technikák: western blot: 1 μg/mL
• NCBI elérési szám: NM_002296
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... LBR(57396)

Leírás

Általános leírás

The protein encoded by this gene belongs to the ERG4/ERG24 family. It localized in the nuclear envelope inner membrane and anchors the lamina and the heterochromatin to the membrane. It may mediate interaction between chromatin and lamin B. Mutations of this gene has been associated with autosomal recessive HEM/Greenberg skeletal dysplasia. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

Immunogen

Synthetic peptide directed towards the middle region of human LBR

Szekvencia

Synthetic peptide located within the following region: GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL

Fizikai forma

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: nwg
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable