SAB2104468

Anti-CEBPD antibody produced in rabbit

affinity isolated antibody

• Szinonimák: Anti-C/EBP-δ, Anti-CELF, Anti-CRP3, Anti-NF-IL6-β
• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: WB
• klón: polyclonal
• faj reaktivitás: rabbit, mouse, human, rat, guinea pig
• technika/technikák: western blot: suitable

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• Forma: buffered aqueous solution
• molekulatömeg: 28 kDa
• faj reaktivitás: rabbit, mouse, human, rat, guinea pig
• koncentráció: 0.5 mg - 1 mg/mL
• technika/technikák: western blot: suitable
• NCBI elérési szám: NM_005195
• UniProt elérési szám: P49716
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... CEBPD(1052)

Leírás

Immunogén

Synthetic peptide directed towards the middle region of human CEBPD

Biokémiai/fiziológiai hatások

CEBPD is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The encoded protein is important in the regulation of genes involved in immune and inf

Szekvencia

Synthetic peptide located within the following region: RNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAG

Fizikai forma

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 3
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable