SAB1411939

ANTI-CDK8 antibody produced in mouse

clone 5H4, purified immunoglobulin, buffered aqueous solution

• Szinonimák: CDK8, K35, MGC126074, MGC126075
• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: ELISA (i); WB
• klón: 5H4, monoclonal
• faj reaktivitás: human,
• technika/technikák: indirect ELISA: suitable; western blot: 1-5 μg/mL

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: 5H4, monoclonal
• Forma: buffered aqueous solution
• molekulatömeg: antigen 35.53 kDa
• faj reaktivitás: human,
• technika/technikák: indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotípus: IgG1κ
• NCBI elérési szám: NM_001260
• UniProt elérési szám: P49336
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... CDK8(1024)

Leírás

Általános leírás

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase and its regulatory subunit cyclin C are components of the RNA polymerase II holoenzyme complex, which phosphorylates the carboxy-terminal domain (CTD) of the largest subunit of RNA polymerase II. This kinase has also been shown to regulate transcription by targeting the CDK7/cyclin H subunits of the general transcription initiation factor IIH (TFIIH), thus providing a link between the ′Mediator-like′ protein complexes and the basal transcription machinery. (provided by RefSeq)

Immunogén

CDK8 (NP_001251, 375 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable