Ugrás a tartalomra
Merck
Összes fotó(2)

Fontos dokumentumok

HPA069577

Sigma-Aldrich

Anti-DUSP1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody

Szinonimák:

CL100, HVH1, MKP-1, PTPN10

Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Összes fotó(2)

About This Item

UNSPSC kód:
12352203
Human Protein Atlas-szám:
HPA069577
NACRES:
NA.41

biológiai forrás

rabbit

Minőségi szint

100

konjugátum

unconjugated

antitest forma

affinity isolated antibody

antitest terméktípus

primary antibodies

klón

polyclonal

termékcsalád

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

faj reaktivitás

human

technika/technikák

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL

immunogén szekvencia

QVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQS

UniProt elérési szám

P28562

kiszállítva

wet ice

tárolási hőmérséklet

−20°C

célzott transzláció utáni módosítás

unmodified

Géninformáció

human ... DUSP1(1843)

Általános leírás

Dual specificity phosphatase 1 (DUSP1) gene encodes for a protein phosphatase enzyme with dual specificity. It is majorly expressed in epithelial tumors, such as prostate, colon, and bladder. DUSP1 protein consists of two domains comprising an amino-terminal noncatalytic domain and a C-terminal catalytic domain, which has an adenosine triphosphatase (ATPase) active site consensus sequence. It belongs to the family of dual-specificity phosphatases. The DUSP1 gene is mapped to human chromosome 5q35.1.

Immunogen

dual specificity phosphatase 1

Alkalmazás

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biokémiai/fiziológiai hatások

Dual specificity phosphatase 1 (DUSP1) protein functions as an activator in the mitogen-activated protein kinase (MAPK) signaling pathway, which dephosphorylate MAP kinase/extracellular-signal-regulated kinase (ERK-2) on tyrosine-185 and threonine-183. This is implicated in signal transduction, protein modification, and oxidative stress in normal cells. DUSP1 regulates invasion, angiogenesis, and metastasis of non-small cell lung cancer. Increased levels of DUSP1 promoter hypermethylation may correlate to tumors and cancer.

Tulajdonságok és előnyök

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Kapcsolódás

Corresponding Antigen APREST90274

Fizikai forma

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Jogi információk

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Nem találja a megfelelő terméket?  

Próbálja ki a Termékválasztó eszköz. eszközt

Tárolási osztály kódja

10 - Combustible liquids

WGK

WGK 1

Lobbanási pont (F)

Not applicable

Lobbanási pont (C)

Not applicable

Analitikai tanúsítványok (COA)

Analitikai tanúsítványok (COA) keresése a termék sarzs-/tételszámának megadásával. A sarzs- és tételszámok a termék címkéjén találhatók, a „Lot” vagy „Batch” szavak után.

Már rendelkezik ezzel a termékkel?

Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.

Dokumentumtár megtekintése

Goot Heah Khor et al.
International journal of medical sciences, 10(12), 1727-1739 (2013-10-25)
Hypermethylation in promoter regions of genes might lead to altered gene functions and result in malignant cellular transformation. Thus, biomarker identification for hypermethylated genes would be very useful for early diagnosis, prognosis, and therapeutic treatment of oral squamous cell carcinoma
Jiliang Shen et al.
Cancer medicine, 5(8), 2061-2068 (2016-05-27)
Dual-specificity phosphatase-1 (DUSP1/MKP1), as a member of the threonine-tyrosine dual-specificity phosphatase family, was first found in cultured murine cells. The molecular mechanisms of DUSP1-mediated extracellular signal-regulated protein kinases (ERKs) dephosphorylation have been subsequently identified by studies using gene knockout mice

Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.

Lépjen kapcsolatba a szaktanácsadással