Ugrás a tartalomra
Merck

HPA007308

Sigma-Aldrich

Anti-NQO1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Szinonimák:

Anti-Azoreductase antibody produced in rabbit, Anti-DT-diaphorase antibody produced in rabbit, Anti-DTD antibody produced in rabbit, Anti-Menadione reductase antibody produced in rabbit, Anti-NAD(P)H dehydrogenase [quinone] 1 antibody produced in rabbit, Anti-NAD(P)H:quinone oxidoreductase 1 antibody produced in rabbit, Anti-Phylloquinone reductase antibody produced in rabbit, Anti-QR1 antibody produced in rabbit, Anti-Quinone reductase 1 antibody produced in rabbit

Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez


About This Item

UNSPSC kód:
12352203
Human Protein Atlas-szám:
NACRES:
NA.43

biológiai forrás

rabbit

Minőségi szint

konjugátum

unconjugated

antitest forma

affinity isolated antibody

antitest terméktípus

primary antibodies

klón

polyclonal

termékcsalád

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

faj reaktivitás

human

fejlettebb validálás

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technika/technikák

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogén szekvencia

FRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKAR

UniProt elérési szám

kiszállítva

wet ice

tárolási hőmérséklet

−20°C

célzott transzláció utáni módosítás

unmodified

Géninformáció

human ... NQO1(1728)

Általános leírás

NAD(P)H:quinone oxidoreductase 1 is a homodimer that is predominantly cytosolic. Each monomer contains one molecule of FAD. The gene is localized to human chromosome 16q22.1 and is a single copy gene. It consists of six exons interspaced by five introns and spans a length of 20kb. The 5′UT, first two amino acids, and the first nucleotide of the third amino acid are encoded by exon 1. The rest of the exons encode the remaining 272 amino acids and the 3′UT.

Immunogen

NAD(P)H dehydrogenase [quinone] 1 recombinant protein epitope signature tag (PrEST)

Alkalmazás

Anti-NQO1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biokémiai/fiziológiai hatások

NQO1 (NAD(P)H:quinone oxidoreductase 1) gene encodes an obligate two-electron reductase that utilizes either NADH or NADPH as a reducing cofactor. It catalyzes reduction of substrates such as quinones, quinone-imines, glutathionyl-substituted naphthoquinones, dichlorophenolindolphenol, methylene blue, azo and nitro compounds, dinitropyrenes, nitrophenylaziridines and nitrobenzamides. It also catalyzes four-electron reduction of azo dyes and nitro compounds. It functions in the detoxification of redox-cycling quinones such as menadione. It also plays the role of an antioxidant by regenerating antioxidant forms of ubiquinone and Vitamin E. By catalyzing these reactions, it protects cells from oxidant stress and electrophilic attack. Defects in this gene have been associated with tardive dyskinesia (TD) and an increased risk of hematotological malignancy after exposure to benzene. Polymorphism in this gene also increases the susceptibility to various cancers

Tulajdonságok és előnyök

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Kapcsolódás

Corresponding Antigen APREST70184

Fizikai forma

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Jogi információk

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Nem találja a megfelelő terméket?  

Próbálja ki a Termékválasztó eszköz. eszközt

Tárolási osztály kódja

10 - Combustible liquids

WGK

WGK 1

Lobbanási pont (F)

Not applicable

Lobbanási pont (C)

Not applicable

Egyéni védőeszköz

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Analitikai tanúsítványok (COA)

Analitikai tanúsítványok (COA) keresése a termék sarzs-/tételszámának megadásával. A sarzs- és tételszámok a termék címkéjén találhatók, a „Lot” vagy „Batch” szavak után.

Már rendelkezik ezzel a termékkel?

Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.

Dokumentumtár megtekintése

Guillaume Beinse et al.
PloS one, 14(3), e0214416-e0214416 (2019-03-26)
NRF2 is a major transcription factor regulating the expression of antioxidative/detoxifying enzymes, involved in oncogenic processes and drug resistance. We aimed to identify molecular alterations associated with NRF2 activation in endometrial carcinoma (EC). Ninety patients treated (2012-2017) for localized/locally advanced
Chang Jiang et al.
Redox biology, 54, 102358-102358 (2022-06-07)
The redox regulator NRF2 is hyperactivated in a large percentage of non-small cell lung cancer (NSCLC) cases, which is associated with chemotherapy and radiation resistance. To identify redox vulnerabilities for KEAP1/NRF2 mutant NSCLC, we conducted a CRISPR-Cas9-based negative selection screen
Yun Yang et al.
Cancer science, 112(2), 641-654 (2020-11-23)
Patients with hepatocellular carcinoma (HCC) are usually diagnosed at the later stages and have poor survival outcomes. New molecules are urgently needed for the prognostic predication and individual treatment. Our study showed that high levels of NQO1 expression frequently exist
Luke M Shelton et al.
Kidney international, 88(6), 1261-1273 (2015-10-01)
The transcription factor Nrf2 exerts protective effects in numerous experimental models of acute kidney injury, and is a promising therapeutic target in chronic kidney disease. To provide a detailed insight into the regulatory roles of Nrf2 in the kidney, we
Yan Zhang et al.
Cancer investigation, 33(2), 39-40 (2015-01-23)
Numerous studies have investigated the association between NQO1 Pro187Ser polymorphism and urinary system cancer risk, but the findings are inconsistent. To derive a more precise estimation of such association, we performed a meta-analysis based on 22 publications encompassing 5,274 cases

Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.

Lépjen kapcsolatba a szaktanácsadással