HPA001520

Anti-ATP5B antibody produced in rabbit

Ab1, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Szinonimák: Anti-ATP synthase subunit β, mitochondrial precursor antibody produced in rabbit
• UNSPSC kód: 12352203
• Human Protein Atlas-szám: HPA001520
• NACRES: NA.43
• konjugátum: unconjugated
• application: IF; IHC
• klón: polyclonal
• faj reaktivitás: rat, human, mouse
• citations: 17
• technika/technikák: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• termékcsalád: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma: buffered aqueous glycerol solution
• faj reaktivitás: rat, human, mouse
• fejlettebb validálás: RNAi knockdown; independent; Learn more about Antibody Enhanced Validation
• technika/technikák: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• immunogén szekvencia: TSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVD
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... ATP5B(506)

Leírás

Általános leírás

ATP5B gene is located on human chromosome 12q13.3. It is located in the inner mitochondrial membrane and majorly expressed in heart.

Adenosine triphosphate (ATP) synthase, H⁺ transporting, mitochondrial F1 complex, ß polypeptide (ATP5B) gene encodes a subunit of mitochondrial ATP synthase that catalyzes ATP synthesis from ADP in the presence of a proton gradient across the membrane. ATP synthase is composed of the catalytic core, F1 and the proton channel, Fo. F1 consists of three each of α and β, and one each of γ, δ and ε subunits. The gene encodes the β subunit.

Immunogén

ATP synthase subunit β, mitochondrial precursor recombinant protein epitope signature tag (PrEST)

Alkalmazás

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-ATP5B antibody produced in rabbit has been used in immunoperoxidase (IPOX) staining.

Anti-ATP5B antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biokémiai/fiziológiai hatások

Adenosine triphosphate (ATP) synthase, H⁺ transporting, mitochondrial F1 complex, β polypeptide (ATP5B) is implicated in colorectal, breast, lung and hepatocellular cancer. Mutations in this gene are associated with acute myeloid leukemia, Parkinson and Huntington disease.

Tulajdonságok és előnyök

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Kapcsolódás

Corresponding Antigen APREST84512

Fizikai forma

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Jogi információk

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1
• Egyéni védőeszköz: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)