Ugrás a tartalomra
Merck
Összes fotó(2)

Fontos dokumentumok

AV36993

Sigma-Aldrich

Anti-TFAM (AB3) antibody produced in rabbit

affinity isolated antibody

Szinonimák:

Anti-AI661103, Anti-Hmgts, Anti-MtTFA, Anti-Transcription factor A, mitochondrial, Anti-TsHMG

Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez


About This Item

UNSPSC kód:
12352203
NACRES:
NA.43

antitest forma

affinity isolated antibody

Minőségi szint

antitest terméktípus

primary antibodies

klón

polyclonal

form

buffered aqueous solution

molekulatömeg

27 kDa

faj reaktivitás

rat, mouse, human

koncentráció

0.5 mg - 1 mg/mL

technika/technikák

immunohistochemistry: suitable
western blot: suitable

NCBI elérési szám

UniProt elérési szám

kiszállítva

wet ice

tárolási hőmérséklet

−20°C

célzott transzláció utáni módosítás

unmodified

Géninformáció

mouse ... Tfam(21780)

Related Categories

Immunogen

Synthetic peptide directed towards the C terminal region of mouse Tfam

Biokémiai/fiziológiai hatások

TFAM a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this protein is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns Sayre syndrome was produced when expression of the gene was eliminated by targeted disruption in heart and muscle cells.

Szekvencia

Synthetic peptide located within the following region: FQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWE

Fizikai forma

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Nem találja a megfelelő terméket?  

Próbálja ki a Termékválasztó eszköz. eszközt

Tárolási osztály kódja

10 - Combustible liquids

WGK

WGK 2

Lobbanási pont (F)

Not applicable

Lobbanási pont (C)

Not applicable


Analitikai tanúsítványok (COA)

Analitikai tanúsítványok (COA) keresése a termék sarzs-/tételszámának megadásával. A sarzs- és tételszámok a termék címkéjén találhatók, a „Lot” vagy „Batch” szavak után.

Már rendelkezik ezzel a termékkel?

Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.

Dokumentumtár megtekintése

Partial Inhibition of Complex I Restores Mitochondrial Morphology and Mitochondria-ER Communication in Hippocampus of APP/PS1 Mice.
Panes, et al.
Cells, 12 (2023)
Jonathan J Herrera et al.
Physiological reports, 12(9), e15997-e15997 (2024-05-03)
Voluntary or forced exercise training in mice is used to assess functional capacity as well as potential disease-modifying effects of exercise over a range of cardiovascular disease phenotypes. Compared to voluntary wheel running, forced exercise training enables precise control of
Andrea Stojakovic et al.
Communications biology, 4(1), 61-61 (2021-01-10)
Alzheimer's Disease (AD) is a devastating neurodegenerative disorder without a cure. Here we show that mitochondrial respiratory chain complex I is an important small molecule druggable target in AD. Partial inhibition of complex I triggers the AMP-activated protein kinase-dependent signaling

Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.

Lépjen kapcsolatba a szaktanácsadással