HPA005464

Anti-FMNL2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-Formin homology 2 domain-containing protein 2, Anti-Formin-like protein 2
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA005464
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Stato: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• tecniche: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Sequenza immunogenica: ERVEELEENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGTIKIQKKGDGDIAILPVVASGTLSMGSEVVAGNSVGP
• N° accesso UniProt: Q96PY5
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... FMNL2(114793)

Descrizione

Descrizione generale

Formin-like 2 (FMNL2) belongs to the family of diaphanous-related formins (DRF), which are ubiquitously expressed and have highly conserved domains. FMNL2 is highly expressed in mammary and gastrointestinal epithelia, placenta, reproductive tract and lymphatic tissues. FMNL2 has two isoforms due to alternative splicing, and they differ at their C-terminals. FMNL2A and FMNL2B have the characteristic FDD and formin homology1 (FH1) and FH2 domains. This gene is localized to chromosome 2q23.3.

Immunogeno

Formin-like protein 2 recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-FMNL2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Azioni biochim/fisiol

Formin-like 2 (FMNL2) regulates actin cytoskeleton, and therefore controls cell motility and migration, cell adhesion, cell polarity, filopodium formation and cytokinesis. It mediates the polymerization of actin via its FH2 domain, while its FH1 domain binds to profilin. Cellular morphological changes are induced by FMNL2, via the N-myristoylation of the involved proteins. It also acts as the effector protein for GTPases belonging to Rho signaling pathway. FMNL2 is down-regulated in hepatocellular carcinoma as compared to normal hepatic epithelial cells. The lower expression of FMNL2 predicts poor prognosis and survival for hepatocellular carcinoma patients. In colorectal carcinoma, it has been implicated in maintaining the epithelial-mesenchymal transition (EMT). Studies show that this protein plays a key role in the metastasis of colorectal cancer.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70050

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable