Direkt zum Inhalt
Merck

N17001

Sigma-Aldrich

Noggin human

recombinant, expressed in HEK 293 cells, suitable for cell culture

Synonym(e):

Noggin human

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise

Größe auswählen

20 μG
CHF 466.00

CHF 466.00


Voraussichtliches Versanddatum16. April 2025


Bulk-Bestellung anfordern

Größe auswählen

Ansicht ändern
20 μG
CHF 466.00

About This Item

MDL-Nummer:
UNSPSC-Code:
12352202
NACRES:
NA.77

CHF 466.00


Voraussichtliches Versanddatum16. April 2025


Bulk-Bestellung anfordern

Rekombinant

expressed in HEK 293 cells

Qualitätsniveau

Assay

≥98% (SDS-PAGE)

Form

lyophilized powder

Wirksamkeit

≤10 ng/mL ED50

Mol-Gew.

23 kDa (The protein migrates as a 25 kDa band on SDS-PAGE due to glycosylation)

Methode(n)

cell culture | mammalian: suitable

Lagertemp.

−20°C

Suchen Sie nach ähnlichen Produkten? Aufrufen Leitfaden zum Produktvergleich

Allgemeine Beschreibung

Recombinant human Noggin is expressed in human 293 cells as a glycoprotein with a calculated molecular mass of 23 kDa. This protein is manufactured in human cells using an all-human production system, with no serum. The human cells expression system allows human-like glycosylation and folding, and often supports better stability of the protein in culture.

Biochem./physiol. Wirkung

Noggin is a secreted protein that inhibits the binding of bone morphogenetic proteins (BMPs) to their cognate receptor. It is a 232 amino acid-secreted glycosylated protein, which forms covalently linked homodimers and has high affinity for BMP4.[1] hESC cultured with noggin (in medium or incorporated into extracellular matrix) form denser colonies compared to normal hESC cultures, suggesting that the presence of noggin promotes better growth. Noggin can be incorporated as a medium supplement for maintaining stem cells in a pluripotent state, for short-term culture experiments. Noggin does not trigger differentiation towards a neuronal lineage. Furthermore, when incorporated into extracellular matrix, noggin prevented spontaneous differentiation during the time period examined. In a surgically induced knee osteoarthritis model in mice, expression of noggin mRNA was lost from the articular cartilage, which correlated with loss of BMP2/4 and pSMAD1/5/8, an indicator of active BMP signaling.

Sequenz

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Physikalische Form

Supplied as a lyophilized powder containing phosphate buffered saline.

Hinweis zur Analyse

The biological activity of recombinant human noggin was tested in culture by measuring its ability to inhibit BMP4-induced alkaline phosphatase production by ATDC5 cells (human erythroleukemic indicator cell line).
The EC50 is defined as the effective concentration of growth factor that elicits a 50% decrease in alkaline phosphatase secretion in a cell based bioassay.

Lagerklassenschlüssel

11 - Combustible Solids

WGK

WGK 2

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

The expression patterns of gremlin 1 and noggin in normal adult and tumor tissues.
Laurilla R, et al.
International Journal of Clinical and Experimental Pathology, 6(7), 1400-1408 (2013)
Wenjing Xiao et al.
Autophagy, 18(11), 2615-2635 (2022-03-08)
Macroautophagy/autophagy is a conserved cellular process associated with tumorigenesis and aggressiveness, while mechanisms regulating expression of autophagic machinery genes in cancers still remain elusive. Herein, we identified E2F4 (E2F transcription factor 4) as a novel transcriptional activator of cytoprotective autophagy

Artikel

Role of growth factors in stem cell differentiation and various growth factors for your research at sigmaaldrich.com

Questions

  1. Buongiorno, che test utilizzate per determinare la concentrazione di noggin? grazie

    1 answer
    1. The concentration of this product is determined by Bradford Assay. Please see the link below to review a sample Certificate of Analysis:
      https://www.sigmaaldrich.com/certificates/sapfs/PROD/sap/certificate_pdfs/COFA/Q14/N17001-20UG-PW057M4890V.pdf

      Helpful?

Reviews

No rating value

Active Filters

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.