Direkt zum Inhalt
Merck

HPA005464

Sigma-Aldrich

Anti-FMNL2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-Formin homology 2 domain-containing protein 2, Anti-Formin-like protein 2

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise

Größe auswählen

100 μL
CHF 556.00

CHF 556.00


Check Cart for Availability


Größe auswählen

Ansicht ändern
100 μL
CHF 556.00

About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

CHF 556.00


Check Cart for Availability

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Erweiterte Validierung

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Methode(n)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

Immunogene Sequenz

ERVEELEENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGTIKIQKKGDGDIAILPVVASGTLSMGSEVVAGNSVGP

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... FMNL2(114793)

Verwandte Kategorien

Allgemeine Beschreibung

Formin-like 2 (FMNL2) belongs to the family of diaphanous-related formins (DRF), which are ubiquitously expressed and have highly conserved domains. FMNL2 is highly expressed in mammary and gastrointestinal epithelia, placenta, reproductive tract and lymphatic tissues. FMNL2 has two isoforms due to alternative splicing, and they differ at their C-terminals. FMNL2A and FMNL2B have the characteristic FDD and formin homology1 (FH1) and FH2 domains. This gene is localized to chromosome 2q23.3.

Immunogen

Formin-like protein 2 recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-FMNL2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

Formin-like 2 (FMNL2) regulates actin cytoskeleton, and therefore controls cell motility and migration, cell adhesion, cell polarity, filopodium formation and cytokinesis. It mediates the polymerization of actin via its FH2 domain, while its FH1 domain binds to profilin. Cellular morphological changes are induced by FMNL2, via the N-myristoylation of the involved proteins. It also acts as the effector protein for GTPases belonging to Rho signaling pathway. FMNL2 is down-regulated in hepatocellular carcinoma as compared to normal hepatic epithelial cells. The lower expression of FMNL2 predicts poor prognosis and survival for hepatocellular carcinoma patients. In colorectal carcinoma, it has been implicated in maintaining the epithelial-mesenchymal transition (EMT). Studies show that this protein plays a key role in the metastasis of colorectal cancer.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST70050

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Katharina Grikscheit et al.
The Journal of cell biology, 209(3), 367-376 (2015-05-13)
Epithelial integrity is vitally important, and its deregulation causes early stage cancer. De novo formation of an adherens junction (AJ) between single epithelial cells requires coordinated, spatial actin dynamics, but the mechanisms steering nascent actin polymerization for cell-cell adhesion initiation
Hanna Grobe et al.
PloS one, 13(3), e0194716-e0194716 (2018-03-27)
De novo formation of epithelial cell-cell contacts relies on actin-based protrusions as well as tightly controlled turnover of junctional actin once cells encounter each other and adhesion complexes assemble. The specific contributions of individual actin regulators on either protrusion formation
Maria Gardberg et al.
BMC cell biology, 11, 55-55 (2010-07-17)
Diaphanous-related formins govern actin-based processes involved in many cellular functions, such as cell movement and invasion. Possible connections to developmental processes and cellular changes associated with malignant phenotype make them interesting study targets. In spite of this, very little is
Xi-Ling Zhu et al.
International journal of colorectal disease, 23(11), 1041-1047 (2008-07-31)
Formin-like 2 (FMNL2) is a member of diaphanous-related formins which can control the actin-dependent processes such as cell motility and invasion. In this study, we investigated the expression of FMNL2 in colorectal cancer (CRC) and its correlation with CRC metastasis.
Koko Moriya et al.
Bioscience, biotechnology, and biochemistry, 76(6), 1201-1209 (2012-07-14)
The subcellular localization of 13 recently identified N-myristoylated proteins and the effects of overexpression of these proteins on cellular morphology were examined with the aim of understanding the physiological roles of the protein N-myristoylation that occurs on these proteins. Immunofluorescence

Questions

Reviews

No rating value

Active Filters

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.