SAB1409030

Monoclonal Anti-HEY1 antibody produced in mouse

clone 4B3, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 4B3, monoclonal
• forma: buffered aqueous solution
• peso molecular: antigen 36.74 kDa
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_012258
• nº de adesão UniProt: Q9Y5J3
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... HEY1(23462)

Descrição

Descrição geral

This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants. (provided by RefSeq)

Imunogênio

HEY1 (NP_036390, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable