HPA024223
Anti-MYO10 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinônimo(s):
Anti-Myosin-X, Anti-Unconventional myosin-10
Faça loginpara ver os preços organizacionais e de contrato
Selecione um tamanho
100 μL
R$ 4.140,00
R$ 4.140,00
Check Cart for Availability
Selecione um tamanho
Alterar visualização
100 μL
R$ 4.140,00
About This Item
R$ 4.140,00
Check Cart for Availability
Produtos recomendados
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
linha de produto
Prestige Antibodies® Powered by Atlas Antibodies
Formulário
buffered aqueous glycerol solution
reatividade de espécies
mouse, human
técnica(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
sequência de imunogênio
QRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLESLNFDEIDECVRNIERSLSVGSEFSSELAESACEEKPNFNFSQPYPEEEVDEGFEADDDAFKDSPNPSEHGHSDQRTSGIRTSDDSSEEDPYMNDTVVPTSPSA
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... MYO10(4651)
Descrição geral
The gene MYO10 (unconventional myosin-10) is mapped to human chromosome 5p15.1. It belongs to the MyTH4-FERM (myosin tail homology 4-band 4.1, ezrin, radixin, moesin, or MF) family of myosins. The protein has a myosin motor domain, a neck consisting of three IQ motifs and a tail region with three pleckstrin homology domains.
Imunogênio
Myosin-X recombinant protein epitope signature tag (PrEST)
Aplicação
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-MYO10 antibody produced in rabbit has ben used in western blotting and immunofluorescence.[1][2]
Anti-MYO10 antibody produced in rabbit has ben used in western blotting and immunofluorescence.[1][2]
Ações bioquímicas/fisiológicas
MYO10 (unconventional myosin-10) is a microtubule-binding myosin. It is essential for centrosome positioning. It is a target gene for microRNA miR-340. In breast cancer, miR-340 inhibits invasion by silencing MYO10, which is responsible for aggressiveness and metastasis in breast cancer. The MYO10 gene is also a direct target of miR-124. Silencing of this gene suppresses cell invasion and metastasis in node-positive non-small cell lung cancer. MYO10 also plays a significant role in wound healing, invadopodia formation and angiogenesis.
Características e benefícios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligação
Corresponding Antigen APREST85234
forma física
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informações legais
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 1
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Escolha uma das versões mais recentes:
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Wan-Hsin Lin et al.
Journal of cell science, 126(Pt 20), 4756-4768 (2013-08-15)
Myosin X (Myo10) is an unconventional myosin with two known isoforms: full-length (FL)-Myo10 that has motor activity, and a recently identified brain-expressed isoform, headless (Hdl)-Myo10, which lacks most of the motor domain. FL-Myo10 is involved in the regulation of filopodia
Myosin-X and disease.
Courson DS and Cheney RE
Experimental Cell Research, 334, 10-15 (2015)
MiR-340 suppresses cell migration and invasion by targeting MYO10 in breast cancer.
Chen CP, et al.
Oncology Reports, 35, 709-716 (2016)
John Caltagarone et al.
Molecular and cellular neurosciences, 68, 120-130 (2015-05-06)
Dopamine transporter (DAT, SLC6A3) controls dopamine (DA) neurotransmission by mediating re-uptake of extracellular DA into DA neurons. DA uptake depends on the amount of DAT at the cell surface, and is therefore regulated by DAT subcellular distribution. Hence we used
Direct Microtubule-Binding by Myosin-10 Orients Centrosomes toward Retraction Fibers and Subcortical Actin Clouds.
Kwon M, et al.
Developmental Cell, 34, 323-337 (2015)
Active Filters
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica
