HPA001239
Anti-MYH7 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinônimo(s):
MYH7 Antibody - Anti-MYH7 antibody produced in rabbit, Myh7 Antibody, Anti-MyHC-β antibody produced in rabbit, Anti-MyHC-slow antibody produced in rabbit, Anti-Myosin heavy chain 7 antibody produced in rabbit, Anti-Myosin heavy chain slow isoform antibody produced in rabbit, Anti-Myosin heavy chain, cardiac muscle β-isoform antibody produced in rabbit, Anti-Myosin-7 antibody produced in rabbit
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Preço e disponibilidade não estão disponíveis no momento.
Produtos recomendados
fonte biológica
rabbit
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
linha de produto
Prestige Antibodies® Powered by Atlas Antibodies
Formulário
buffered aqueous glycerol solution
reatividade de espécies
human
técnica(s)
immunohistochemistry: 1:1000- 1:2500
sequência de imunogênio
ALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQS
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... MYH7(4625)
Categorias relacionadas
Descrição geral
Myosin heavy chain 7 (MYH7) comprises the N-terminal head domain and C-terminal rod domain. It also harbors the light meromyosin domain and actin-binding domain. The MYH7 gene is mapped to human chromosome location 14q11.2.
Imunogênio
Myosin-7 recombinant protein epitope signature tag (PrEST)
Aplicação
Anti-MYH7 antibody produced in rabbit has been used in:
- western blotting[1]
- immunohistochemistry
- immunofluorescence staining (1:100)
Anti-MYH7 antibody produced in rabbit is suitable for immunostaining to examine protein expression patterns in human cardiac sections using Protein Atlas confocal database.
Anti-MYH7 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Anti-MYH7 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Ações bioquímicas/fisiológicas
MYH7 (myosin, heavy chain 7, cardiac muscle, β) gene encodes the beta heavy chain subunit of cardiac myosin. It functions in muscle contraction. It is highly expressed in normal human ventricle and also in skeletal muscle tissues rich in slow-twitch type I muscle fibers. The expression of this protein is altered during thyroid hormone depletion and hemodynamic overloading. Defects in this gene cause familial hypertrophic cardiomyopathy, myosin storage myopathy, dilated cardiomyopathy, and Laing early-onset distal myopathy.
Características e benefícios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligação
Corresponding Antigen APREST70519
forma física
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informações legais
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 1
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Equipamento de proteção individual
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Escolha uma das versões mais recentes:
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Os clientes também visualizaram
C Fiorillo et al.
Orphanet journal of rare diseases, 11(1), 91-91 (2016-07-09)
Myosin heavy chain 7 (MYH7)-related myopathies are emerging as an important group of muscle diseases of childhood and adulthood, with variable clinical and histopathological expression depending on the type and location of the mutation. Mutations in the head and neck
Wenkun Dou et al.
Biosensors & bioelectronics, 175, 112875-112875 (2020-12-12)
The use of human induced pluripotent stem cell-derived cardiomyocytes (iPSC-CMs) as an in vitro model of the heart is limited by their structurally and functionally immature phenotypes. During heart development, mechanical stimuli from in vivo microenvironments are known to regulate
Catherine E Alessi et al.
Journal of clinical neuromuscular disease, 22(1), 22-34 (2020-08-25)
Laing distal myopathy (LDM) is an autosomal dominant disorder caused by mutations in the slow skeletal muscle fiber myosin heavy chain (MYH7) gene on chromosome 14q11.2. The classic LDM phenotype-including early-onset, initial involvement of foot dorsiflexors and great toe extensors
Hiroyuki Iwaki et al.
PloS one, 9(4), e88610-e88610 (2014-05-02)
MYH7 (also referred to as cardiac myosin heavy chain β) gene expression is known to be repressed by thyroid hormone (T3). However, the molecular mechanism by which T3 inhibits the transcription of its target genes (negative regulation) remains to be
Chao Song et al.
Frontiers in cell and developmental biology, 10, 762129-762129 (2022-04-19)
Pathway analysis is considered as an important strategy to reveal the underlying mechanisms of diseases. Pathways that are involved in crosstalk can regulate each other and co-regulate downstream biological processes. Furthermore, some genes in the pathways can function with other
Active Filters
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica
