Pular para o conteúdo
Merck
Todas as fotos(8)

Documentos Principais

AMAB90859

Sigma-Aldrich

Monoclonal Anti-MCL1 antibody produced in mouse

Prestige Antibodies® Powered by Atlas Antibodies, clone CL1128, purified immunoglobulin, buffered aqueous glycerol solution

Sinônimo(s):

BCL2L3, Mcl-1

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

100 μL
R$ 4.047,00

R$ 4.047,00


Check Cart for Availability


Selecione um tamanho

Alterar visualização
100 μL
R$ 4.047,00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

R$ 4.047,00


Check Cart for Availability

fonte biológica

mouse

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

CL1128, monoclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human

técnica(s)

immunoblotting: 1 μg/mL
immunofluorescence: 2-10 μg/mL (Fixation/Permeabilization: PFA/Triton X-100)
immunohistochemistry: 1:500- 1:1000

Isotipo

IgG1

Ensembl | Número de adesão de ser humano

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... MCL1(4170)

Descrição geral

Induced myeloid leukemia cell differentiation protein (Mcl-1) belongs to B-cell lymphoma 2 (Bcl-2) apoptotic protein family. The Mcl-1 gene is mapped to human chromosome 1q21. It encodes a protein of 42 kDa. The alternate spliced variant is a small protein of 30 kDa. It contains three Bcl-2 homology (BH) domains whereas the alternate spliced has only one BH domain.

Imunogênio

myeloid cell leukemia sequence 1 (BCL2-related), recombinant protein epitope signature tag (PrEST)

Sequence
DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG

Epitope
Binds to an epitope located within the peptide sequence PEEELDGYEP as determined by overlapping synthetic peptides.

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Ações bioquímicas/fisiológicas

Induced myeloid leukemia cell differentiation protein (Mcl-1) functions as anti-apoptotic protein. Mcl-1 is upregulated in several carcinomas and is a key factor contributing to drug resistance in chemotherapies. It favors tumorigenesis in multiple myeloma and plays a crucial role in tumor progression. Spliceosome based inhibitors for Mcl-1 are suggested for prevent cancer metastasis.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST70113

forma física

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Structure-Function Analysis of Mcl-1 Identifies a Novel Senescence Regulating Domain
Demelash A, et al.
The Journal of Biological Chemistry, 3(10), jbc-M115 (2015)
Mcl-1; the molecular regulation of protein function
Thomas LW, et al.
Febs Letters, 584(14), 2981-2989 (2010)
Mcl-1 regulation and its role in multiple myeloma
Gouill SL, et al.
Cell Cycle, 3(10), 1259-1262 (2004)
Regulation of apoptosis and cell cycle progression by MCL1: Differential role of PCNA
Fujise K, et al.
The Journal of Biological Chemistry, 129(10), 2497-2506 (2000)
Modification of alternative splicing of Mcl-1 pre-mRNA using antisense morpholino oligonucleotides induces apoptosis in basal cell carcinoma cells
Shieh JJ, et al.
The Journal of Investigative Dermatology, 129(10), 2497-2506 (2009)

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica