WH0055212M1

Monoclonal Anti-BBS7 antibody produced in mouse

clone 2H6, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-BBS2L1, Anti-Bardet-Biedl syndrome 7, Anti-FLJ10715
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 2H6, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• GenBank-Hinterlegungsnummer: NM_018190
• UniProt-Hinterlegungsnummer: Q8IWZ6
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... BBS7(55212)

Beschreibung

Allgemeine Beschreibung

Mutations in this gene have been observed in patients with Bardet-Biedl syndrome type 7. The encoded protein may play a role in eye, limb, cardiac and reproductive system development. Two transcript variants encoding distinct isoforms have been identified for this gene. (provided by RefSeq)

Immunogen

BBS7 (NP_060660, 574 a.a. ~ 672 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEGNTNFLIPEYHCILEEADHLQEEYKKQPAHLERLYG

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: nwg
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)