WH0008841M2

Monoclonal Anti-HDAC3 antibody produced in mouse

clone 3E11, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-HD3, Anti-RPD3, Anti-RPD32, Anti-histone deacetylase 3
• MDL-Nummer: MFCD02096545
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 3E11, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: rat, mouse, human
• Methode(n): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• GenBank-Hinterlegungsnummer: NM_003883
• UniProt-Hinterlegungsnummer: O15379
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... HDAC3(8841)

Beschreibung

Allgemeine Beschreibung

Histone deacetylase 3 (HDAC3) is an epigenetic modifier and is expressed in various tissues. It belongs to the class I subfamily of histone deacetylases. The HDAC3 gene is localized on human chromosome 5q31.3.

Immunogen

HDAC3 (NP_003874, 319 a.a. ~ 428 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)