SAB2108827

Anti-DAG1 antibody produced in rabbit biotin conjugted

affinity isolated antibody

• UNSPSC-Code: 12352203
• NACRES: NA.45

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: biotin conjugate
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 27 kDa
• Speziesreaktivität (Voraussage durch Homologie): zebrafish, bovine, guinea pig, rabbit, canine, horse, pig, mouse, human
• Konzentration: 0.5 mg/mL
• Methode(n): immunohistochemistry (formalin-fixed, paraffin-embedded sections): 4-8 μg/mL
• NCBI-Hinterlegungsnummer: NM_004393
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... DAG1(1605)

Beschreibung

Allgemeine Beschreibung

This gene encodes dystroglycan, a central component of dystrophin-glycoprotein complex that links the extracellular matrix and the cytoskeleton in the skeletal muscle. The encoded preproprotein undergoes O- and N-glycosylation, and proteolytic processing to generate alpha and beta subunits. Certain mutations in this gene are known to cause distinct forms of muscular dystrophy. Alternative splicing results in multiple transcript variants, all encoding the same protein.

Immunogen

Synthetic peptide directed towards the middle region of human alpha-DAG1

Sequenz

Synthetic peptide located within the following region: AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT

Physikalische Form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: nwg
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable