Direkt zum Inhalt
Merck

HPA043264

Sigma-Aldrich

Anti-HSD3B1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-HSD3B, Anti-HSDB3, Anti-SDR11E1

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise

Größe auswählen

100 μL
€ 505,00

€ 505,00


Versand in der Regel in 1 Woche. (Bei Bestellungen außerhalb der USA und Europas rechnen Sie bitte zusätzlich 1-2 Wochen für die Lieferung ein)


Größe auswählen

Ansicht ändern
100 μL
€ 505,00

About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.43

€ 505,00


Versand in der Regel in 1 Woche. (Bei Bestellungen außerhalb der USA und Europas rechnen Sie bitte zusätzlich 1-2 Wochen für die Lieferung ein)

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Methode(n)

immunohistochemistry: 1:20- 1:50

Immunogene Sequenz

RHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKT

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... HSD3B1(3283)

Verwandte Kategorien

Allgemeine Beschreibung

3 β-hydroxysteroid dehydrogenase/delta 5->4-isomerase type 1 (HSD3B1) is a key enzyme essential for the formation of steroid sex hormones. It is majorly expressed in mammary glands, prostate, placenta and sebaceous glands of skin. HSD3B1 gene is mapped to human chromosome 1p12 and has four exons.

Immunogen

hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem./physiol. Wirkung

3 β-hydroxysteroid dehydrogenase/delta 5->4-isomerase type 1 (HSD3B1) catalyses the conversion of steroid dehydroepiandrosterone sulfate to estrogen precursors hormones. It regulates levels of dihydrotestosterone (DHT). HSD3B1 is highly expressed in breast cancer and HSD3B1 gene knockdown results in tumor growth inhibition. A single nucleotide polymorphism in the HSD3B1 gene enhances enzyme activity and improves dihydrotestosterone (DHT) production in castration-resistant prostate cancer (CRPC). Expression of HSD3B1 is downregulated in ovarian cancer. Polymorphism in HSD3B1 is implicated in individuals with hypertension.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST82530

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Human 3beta-hydroxysteroid dehydrogenase type 1 in human breast cancer: clinical significance and prognostic associations
Hanamura T, et al.
Cancer Medicine, 5(7), 1405-1415 (2016)
Polymorphism in exon 4 of the human 3beta-hydroxysteroid dehydrogenase type I gene (HSD3B1) and blood pressure
Rosmond R, et al.
Biochemical and Biophysical Research Communications, 293(1), 629-632 (2002)
Metabolism of dihydrotestosterone in human liver: importance of 3alpha-and 3beta hydroxysteroid dehydrogenase
Pirog EC and Collins DC
The Journal of Clinical Endocrinology and Metabolism, 84(9), 3217-3221 (1999)
Characterization of human 3 beta-hydroxysteroid dehydrogenase/delta 5-delta 4-isomerase gene and its expression in mammalian cells.
Lachance Y, et al.
The Journal of Biological Chemistry, 265(33), 20469-20475 (1990)
Expression of 3beta-hydroxysteroid dehydrogenase type 1 in breast cancer is associated with poor prognosis independent of estrogen receptor status
Chang Y, et al.
Annals of Surgical Oncology, 24(13), 4033-4041 (2017)

Questions

Reviews

No rating value

Active Filters

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.