Direkt zum Inhalt
Merck

AV32470

Sigma-Aldrich

Anti-SUV39H1 Histone Methyltransferase antibody

rabbit polyclonal

Synonym(e):

Anti-KMT1A, Anti-MG44, Anti-SUV39H, Anti-Suppressor of variegation 3-9 homolog 1 (Drosophila)

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise

Größe auswählen

100 μL
€ 327,00

€ 327,00


Versand innerhalb von 5 Werktagen. (Bei Bestellungen außerhalb der USA rechnen Sie bitte zusätzlich 1-2 Wochen für die Lieferung ein)


Größe auswählen

Ansicht ändern
100 μL
€ 327,00

About This Item

UNSPSC-Code:
12352203
NACRES:
NA.41

€ 327,00


Versand innerhalb von 5 Werktagen. (Bei Bestellungen außerhalb der USA rechnen Sie bitte zusätzlich 1-2 Wochen für die Lieferung ein)

Produktbezeichnung

Anti-SUV39H1 antibody produced in rabbit, IgG fraction of antiserum

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

IgG fraction of antiserum

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Form

buffered aqueous solution

Mol-Gew.

48 kDa

Speziesreaktivität

rat, bovine, guinea pig, dog, rabbit, mouse, human

Konzentration

0.5 mg - 1 mg/mL

Methode(n)

immunohistochemistry: suitable
western blot: suitable

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... SUV39H1(6839)

Allgemeine Beschreibung

Rabbit polyclonal anti-SUV39H1 antibody reacts with human, mouse, rat, zebrafish, bovine, and canine suppressor of variegation 3-9 homolog 1 enzymes.
Suppressor of variegation 3-9 homolog 1 (SUV39H1, KMT1A, MG44) is a histone-lysine N-methyltransferase that methylates lys-9 of histone H3. SUV39H1 is involved in heterochromatin organization, chromosome segregation, and mitotic progression. SUV39H1 generates a gradient of methylation marks at the kinetochore to spatiotemporally direct accurate chromosome segregation in mitosis. Suv39H1 interacts with Snail to mediated E-cadherin, a hallmark of epithelial-mesenchymal transition (EMT), repression in breast cancer.

Immunogen

Synthetic peptide directed towards the C terminal region of human SUV39H1

Anwendung

Rabbit Anti-SUV39H1 antibody can be used for western blot applications at a concentration of 1.25μg/ml.
Rabbit polyclonal anti-SUV39H1 antibody is used to tag suppressor of variegation 3-9 homolog 1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of suppressor of variegation 3-9 homolog 1 in the regulation of chromatin organization and chromosome segregation and as a regulator or cancer progression via E-cadherin-dependent epithelial-mesenchymal transition (EMT).

Biochem./physiol. Wirkung

SUV39H1, a human homolog of the Drosophila position effect variegation modifier Su(var)3-9 and of the S. pombe silencing factor clr4, encodes a heterochromatic protein that transiently accumulates at centromeric positions during mitosis.This gene is a member of the suppressor of variegation 3-9 homolog family and encodes a protein with a chromodomain and a C-terminal SET domain. This nuclear protein moves to the centromeres during mitosis and functions as a histone methyltransferase, methylating Lys-9 of histone H3. Overall, it plays a vital role in heterochromatin organization, chromosome segregation, and mitotic progression. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequenz

Synthetic peptide located within the following region: FDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 3

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Yan Chen et al.
PeerJ, 12, e17222-e17222 (2024-04-23)
Targeting tumor angiogenesis is an important approach in advanced tumor therapy. Here we investigated the effect of the suppressor of variegation 3-9 homolog 1 (SUV39H1) on tumor angiogenesis in oral squamous cell carcinoma (OSCC). The GEPIA database was used to
Svetlana Sharifulina et al.
International journal of molecular sciences, 22(22) (2021-11-28)
Cerebral ischemia, a common cerebrovascular disease, is one of the great threats to human health and new targets for stroke therapy are needed. The transcriptional activity in the cell is regulated by epigenetic processes such as DNA methylation/demethylation, acetylation/deacetylation, histone

Questions

  1. What is the similarity between the immunogen and the zebrafish protein in the anti-SUV39H1 antibody (AV32470) that I'm considering for use in zebrafish?

    1 answer
    1. Based on the immunogen sequence, the homology is as follows: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%.

      Helpful?

Reviews

No rating value

Active Filters

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.