Product Name
Monoclonal Anti-THY1 antibody produced in mouse, Prestige Antibodies® Powered by Atlas Antibodies, clone CL1028, purified immunoglobulin, buffered aqueous glycerol solution
biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
CL1028, monoclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
Quality Level
Gene Information
human ... THY1(7070)
concentration
1 mg/mL
technique(s)
immunoblotting: 1 μg/mL
pH range
7.2-7.4
isotype
IgG2b
Ensembl | human accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
1 of 4
This Item | AMAB90846 | WH0007070M1 | SAB4200497 |
|---|---|---|---|
| Gene Information human ... THY1(7070) | Gene Information human ... THY1(7070) | Gene Information human ... THY1(7070) | Gene Information human ... THY1(7070) |
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| antibody form purified immunoglobulin | antibody form purified immunoglobulin | antibody form purified immunoglobulin | antibody form purified from hybridoma cell culture |
| biological source mouse | biological source mouse | biological source mouse | biological source mouse |
| clone CL1028, monoclonal | clone CL1040, monoclonal | clone 3F9, monoclonal | clone TH350, monoclonal |
| species reactivity human | species reactivity human | species reactivity human | species reactivity mouse, human, rat |
Application
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Disclaimer
Features and Benefits
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Immunogen
Sequence
VTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWL
Epitope
Binds to an epitope located within the peptide sequence ACLVDQSLRLDCRHE as determined by overlapping synthetic peptides.
Physical form
Legal Information
Preparation Note
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk
WGK 1
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service


