Key Documents

View All Documentation

Anti-NUDCD3 antibody produced in rabbit

Name: Anti-NUDCD3 antibody produced in rabbit
Brand: SIGMA
Price: 881 CAD

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

Synonym(s):

Anti-NudC domain-containing protein 3

Select a Size

Change View

Pack Size	SKU	Availability	Price
100 μL		Please contact Customer Service for Availability	$881.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA019136

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC, WB

Citations:

$881.00

Please contact Customer Service for Availability

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

independent
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:500-1:1000, western blot: 0.04-0.4 μg/mL

immunogen sequence

RRKEEEEAKTVSAAAAEKEPVPVPVQEIEIDSTTELDGHQEVEKVQPPGPVKEMAHGSQEAEAPGAVAGAAE

UniProt accession no.

Q8IVD9

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NUDCD3(23386)

Description

General description

The gene NUDCD3 (NudC domain-containing gene 3) is mapped to human chromosome 7p13-p12. The protein localizes to the centrosome and midbody.

Immunogen

NudC domain-containing protein 3 recombinant protein epitope signature tag (PrEST)

Application

Anti-NUDCD3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence[1] and western blotting.[1] To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

NUDCD3 (NudC domain-containing gene 3) is involved in cytokinesis by stabilization of dynein intermediate chain. Absence of NUDCD3 induces mitotic defects. Disturbances in NUDCD3 levels cause mislocalization of the dynein complex from kinetochores, spindle microtubules, and spindle poles, aggregation of dynein intermediate chain in the cytoplasm and degradation of dynein intermediate chain.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST74853

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA019528	HPA019529	HPA037385
Sigma-Aldrich HPA019136 Anti-NUDCD3 antibody produced in rabbit	Sigma-Aldrich HPA019528 Anti-NUDCD3 antibody produced in rabbit	Sigma-Aldrich HPA019529 Anti-NUDCD3 antibody produced in rabbit	Sigma-Aldrich HPA037385 Anti-NUDCD2 antibody produced in rabbit
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
technique(s) immunofluorescence: 0.25-2 μg/mL, western blot: 0.04-0.4 μg/mL, immunohistochemistry: 1:500-1:1000	technique(s) immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:50-1:200	technique(s) immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:50-1:200	technique(s) immunohistochemistry: 1:200- 1:500

Still not finding the right product?

Explore all of our products under Anti-NUDCD3 antibody produced in rabbit

— or —

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

R08258

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Cancer-testis antigen BORIS is a novel prognostic marker for patients with esophageal cancer.

Koji Okabayashi et al.

Cancer science, 103(9), 1617-1624 (2012-06-09)

Esophageal squamous cell cancer (ESCC) is one of the most common lethal tumors in the world, and development of new diagnostic and therapeutic methods is needed. In this study, cancer-testis antigen, BORIS, was isolated by functional cDNA expression cloning using

Inhibition of cytokinesis by overexpression of NudCL that is localized to the centrosome and midbody.

Yuqi Cai et al.

Cell research, 19(11), 1305-1308 (2009-10-07)

A mammalian NudC-like protein essential for dynein stability and cell viability.

Tianhua Zhou et al.

Proceedings of the National Academy of Sciences of the United States of America, 103(24), 9039-9044 (2006-06-07)

Cytoplasmic dynein, a minus-end-directed microtubule motor, has been implicated in many fundamental cellular processes; however, little is known regarding the underlying molecular machinery that regulates its stability. In Aspergillus nidulans, nuclear distribution gene C (nudC) has been implicated in the

View All Related Papers

Global Trade Item Number

SKU	GTIN
HPA019136-25UL	04061842867158
HPA019136-100UL	04061836312589

Questions

Reviews

No rating value