WH0245973M1

Monoclonal Anti-ATP6V1C2 antibody produced in mouse

clone 3D5, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-ATP6C2, Anti-ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C isoform 2, Anti-VMA5
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 3D5, monoclonal
• Formularz: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG2bκ
• numer dostępu GenBank: NM_144583
• numer dostępu UniProt: Q8NEY4
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... ATP6V1C2(245973)

Opis

Opis ogólny

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A,three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain C subunit isoforms. (provided by RefSeq)

Immunogen

ATP6V1C2 (NP_653184, 188 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYD

Cechy i korzyści

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): nwg
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)