WH0004780M1

Monoclonal Anti-NFE2L2 antibody produced in mouse

clone 1F3, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-NRF2, Anti-nuclear factor (erythroid-derived 2)-like 2
• Kod UNSPSC: 12352203

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 1F3, monoclonal
• Postać: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: suitable
• izotyp: IgG2bκ
• sekwencja immunogenna: FAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVA (without GST)
• numer dostępu UniProt: Q16236
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... NFE2L2(4780)

Opis

Immunogen

NFE2L2 (AAH11558, a.a. 71-170) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.2

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 12 - Non Combustible Liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)