Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Kluczowe dokumenty

WH0004647M1

Sigma-Aldrich

Monoclonal Anti-MYO7A antibody produced in mouse

clone 1D3, purified immunoglobulin, buffered aqueous solution

Synonim(y):

Anti-DFNA11, Anti-DFNB2, Anti-MYU7A, Anti-NSRD2, Anti-USH1B, Anti-myosin VIIA

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Numer MDL:
Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

mouse

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

1D3, monoclonal

Postać

buffered aqueous solution

reaktywność gatunkowa

human

metody

indirect ELISA: suitable

izotyp

IgG1κ

numer dostępu GenBank

numer dostępu UniProt

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... MYO7A(4647)

Opis ogólny

MYO7A (myosin VIIA) or HM7A consists of 5 isoleucine-glutamine (IQ) motifs. It is present in retinal epithelial cells. It also interacts with other USH1 (Usher syndrome type 1B) gene products like harmonin and sans. This gene is located on human chromosome 11q13.

Immunogen

MYO7A (NP_000251, 2118 a.a. ~ 2213 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KQTTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRS

Działania biochem./fizjol.

MYO7A (myosin VIIA) or HM7A is involved in anchoring and holding membrane-bound elements to the actin core of the stereocilium. It acts as a transporter. This protein may participate in the tethering of melanosomes at the root of actin bundles. HM7A is responsible for Usher syndrome type 1B. In mice and humans, alteration in Myo7a causes hereditary deafness.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

The genomic structure of the gene defective in Usher syndrome type Ib (MYO7A)
Kelley PM, et al.
Genomics, 40(1), 73-79 (1997)
Structure and Regulation of the Movement of Human Myosin VIIA
Sakai T, et al.
The Journal of Biological Chemistry, 17587-17598 (2015)
Reduced climbing and increased slipping adaptation in cochlear hair cells of mice with Myo7a mutations
Kros CJ, et al.
Nature Neuroscience (2002)

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej