SAB2109199

Anti-SEZ6 (C-terminal) antibody produced in rabbit

affinity isolated antibody

• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 105 kDa
• reaktywność gatunkowa (przewidywana na podstawie homologii): human, bovine, mouse, rabbit, rat, canine, horse
• stężenie: 0.5 mg/mL
• metody: western blot: 1 μg/mL
• numer dostępu NCBI: NM_178860
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SEZ6(57396)

Opis

Opis ogólny

SEZ6 may play a role in cell-cell recognition and in neuronal membrane signaling. It seems to be important for the achievement of the necessary balance between dendrite elongation and branching during the elaboration of a complex dendritic arbor. SEZ6 is involved in the development of appropriate excitatory synaptic connectivity.

Immunogen

Synthetic peptide directed towards the C-terminal region of Human SEZ6

Sekwencja

Synthetic peptide located within the following region: RAPKCLLEQLKPCHGLSAPENGARSPEKQLHPAGATIHFSCAPGYVLKGQ

Postać fizyczna

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): nwg
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable