Przejdź do zawartości
Merck

SAB1403063

Sigma-Aldrich

Monoclonal Anti-KLF2 antibody produced in mouse

clone 1D1, purified immunoglobulin, buffered aqueous solution

Synonim(y):

LKLF

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

mouse

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

1D1, monoclonal

Postać

buffered aqueous solution

masa cząsteczkowa

antigen ~35.79 kDa

reaktywność gatunkowa

human

metody

indirect ELISA: suitable
western blot: 1-5 μg/mL

izotyp

IgG2aκ

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... KLF2(10365)

Powiązane kategorie

Opis ogólny

Kruppel like factor 2 (KLF2) is a tumor-suppressor gene, localized on human chromosome 19p13.11.

Immunogen

KLF2 (NP_057354, 263 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH

Działania biochem./fizjol.

Kruppel like factor 2 (KLF2) is crucial for lung functioning, cell differentiation, migration and tissue development. It modulates endothelial pro-inflammatory activation. The protein has roles in cardiovascular development and T-cell differentiation. Mutation in the gene encoding it has been associated with heritable pulmonary arterial hypertension.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Not finding the right product?  

Try our Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 1

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

A study of the relationships between KLF2polymorphisms and body weight control in a French population
Aline Meirhaeghe
BMC Medical Genetics (2006)
W P Ries et al.
Annals of the Royal College of Surgeons of England, 101(8), 609-616 (2019-09-12)
Hypothermic machine perfusion, an organ preservation modality, involves flow of chilled preservation fluid through an allograft's vasculature. This study describes a simple, reproducible, human model that allows for interrogation of flow effects during ex vivo organ perfusion. Gonadal veins from
First identification of Kruppel-like factor 2 mutation in heritable pulmonary arterial hypertension.
Eichstaedt CA
Clinical Science (2017)
Rafal Bartoszewski et al.
European journal of cell biology, 96(8), 758-766 (2017-10-19)
The role of microRNAs in controlling angiogenesis is recognized as a promising therapeutic target in both cancer and cardiovascular disorders. However, understanding a miRNA's pleiotropic effects on angiogenesis is a limiting factor for these types of therapeutic approaches. Using genome-wide
Kruppel-like factor 2 suppresses growth and invasion of gastric cancer cells in vitro and in vivo.
Mao QQ
Journal of Biological Regulators and Homeostatic Agents (2016)

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej