HPA011271

Anti-ANXA1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonim(y): Anti-Annexin A1, Anti-Annexin I, Anti-Annexin-1, Anti-Calpactin II, Anti-Chromobindin-9, Anti-Lipocortin I, Anti-Phospholipase A2 inhibitory protein, Anti-p35
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA011271
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Postać: buffered aqueous glycerol solution
• reaktywność gatunkowa: mouse, rat, human
• rozszerzona walidacja: orthogonal RNAseq; independent; RNAi knockdown; Learn more about Antibody Enhanced Validation
• metody: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:1000-1:2500
• sekwencja immunogenna: FRNALLSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFNTILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIMV
• numer dostępu UniProt: P04083
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... ANXA1(301)

Opis

Opis ogólny

Annexin A1 (ANXA1) belongs to the annexin gene family and is a part of the A subfamily. It is a glucocorticoid-regulated, calcium and phospholipid-binding protein. This protein has a molecular weight of 37kDa.

Immunogen

Annexin A1 recombinant protein epitope signature tag (PrEST)

Zastosowanie

Anti-ANXA1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Działania biochem./fizjol.

Annexin A1 (ANXA1) is involved in multiple cellular functions such as, cell proliferation and differentiation and signal transduction. Its expression is deregulated in various cancers such as, glial tumors, nasopharyngeal carcinoma, head and neck, larynx, esophageal, breast, hepatocellular, gastric, prostate and pancreatic cancer. It is up-regulated in rectal cancer and predicts poor prognostic response to concurrent chemoradiotherapy. ANXA1 is involved in anti-inflammatory processes, and regulates apoptosis and phagocytosis of apoptotic bodies. Its expression levels are altered in cystic fibrosis, and might be involved in the pathogenesis of glomerular disorders. It has potential as a marker for the diagnosis and prognosis of glomerular disorders. ANXA1 has a high level of expression in normal gastrointestinal epithelium, and might be involved in the maintenance of cellular boundaries. It also regulates gastric cancer cell proliferation and viability through COX2 (cyclooxygenase 2) pathway.

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST71575

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)