Przejdź do zawartości
Merck
Wszystkie zdjęcia(8)

Kluczowe dokumenty

HPA008736

Sigma-Aldrich

Anti-DAXX antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):

Anti-Daxx antibody produced in rabbit, Anti-Death domain-associated protein 6 antibody produced in rabbit, Anti-EAP1 antibody produced in rabbit, Anti-ETS1-associated protein 1 antibody produced in rabbit, Anti-Fas death domain-associated protein antibody produced in rabbit, Anti-hDaxx antibody produced in rabbit

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych

Wybierz wielkość

100 μL
2440,00 zł

2440,00 zł


Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności


Wybierz wielkość

Zmień widok
100 μL
2440,00 zł

About This Item

Numer MDL:
Kod UNSPSC:
12352203
Numer w atlasie ludzkich białek:
NACRES:
NA.41

2440,00 zł


Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności

pochodzenie biologiczne

rabbit

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

Formularz

buffered aqueous glycerol solution

reaktywność gatunkowa

human

rozszerzona walidacja

recombinant expression
RNAi knockdown
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

metody

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

sekwencja immunogenna

DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSG

numer dostępu UniProt

Zastosowanie

research pathology

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... DAXX(1616)

Opis ogólny

DAXX (death-domain associated protein) is a nuclear protein, which is highly conserved in nature. It shuttles between nucleus and cytoplasm.[1] It was originally identified as a FAS-interacting protein, which induces FAS-mediated apoptosis. This gene is localized to human chromosome 6p21.3 in the MHC (major histocompatibility complex) locus. The encoded protein contains FAS-binding region in its C-terminal. It contains two putative nuclear localization signals.

Immunogen

Death domain-associated protein 6 recombinant protein epitope signature tag (PrEST)

Zastosowanie

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-DAXX antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry[2] against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Działania biochem./fizjol.

DAXX (death-domain associated protein) plays essential roles in control of transcription and viral infection and carcinogenesis. It controls multiple signaling pathways involved in cell survival and death. It forms a constitutive constituent of promyleocytic leukaemia protein (PML) nuclear bodies (PML-NBs). In human papillomavirus (HPV)-induced cervical carcinoma, this protein translocates gradually from nucleus to nuclear membrane to cytoplasm to plasma membrane.[1] It acts as a bifunctional protein at centrosomic/pericentrosomic heterochromatin, where it controls the loading of heat shock protein H3.3 under normal conditions and the protection epigenetic identity of heterochromatin during stress conditions. The subcellular localization of this protein determines the sensitivity of macrophages to oxidized low density lipoprotein (ox-LDL), where its nuclear localization can negate the effect of ox-LDL.

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST86890

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 1

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

The Daxx enigma.
Michaelson J S
Apoptosis, 5(3), 217-220 (2000)
Guozuo Xiong et al.
Molecular biology reports, 41(11), 7183-7190 (2014-08-15)
Here we aimed to evaluate the effects of DAXX subcellular localization on ox-LDL induced macrophages apoptosis. Cytoplasmic localization vector DAXX-W621A and nuclear localization vector DAXX-S667A were constructed by point mutation in DAXX. Blank vector, full length DAXX, DAXX-W621A, DAXX-S667A was
Christian Geis et al.
The Journal of surgical research, 194(2), 388-393 (2014-12-03)
Neuroendocrine tumors (NETs) of the ileum are sporadic tumors derived from submucosal gastrointestinal stem cells. They often show clinical symptoms only after hepatic metastasation when curative therapy is limited or impossible. In this study, we analyzed the expression of the
Epigenetic dysregulation and poorer prognosis in DAXX-deficient pancreatic neuroendocrine tumours.
Christodoulos P Pipinikas et al.
Endocrine-related cancer, 22(3), L13-L18 (2015-04-23)
Roeland F de Wilde et al.
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc, 25(7), 1033-1039 (2012-05-12)
Approximately 45% of sporadic well-differentiated pancreatic neuroendocrine tumors harbor mutations in either ATRX (alpha thalassemia/mental retardation X-linked) or DAXX (death domain-associated protein). These novel tumor suppressor genes encode nuclear proteins that interact with one another and function in chromatin remodeling

Questions

Reviews

No rating value

Active Filters

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej