AV41333
Anti-DCX (AB1) antibody produced in rabbit
affinity isolated antibody
Synonim(y):
Anti-DBCN, Anti-DC, Anti-Doublecortex; lissencephaly, X-linked (doublecortin), Anti-LISX, Anti-SCLH, Anti-XLIS
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Kod UNSPSC:
12352203
NACRES:
NA.41
Polecane produkty
pochodzenie biologiczne
rabbit
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
affinity isolated antibody
rodzaj przeciwciała
primary antibodies
klon
polyclonal
Postać
buffered aqueous solution
masa cząsteczkowa
40 kDa
reaktywność gatunkowa
human, rat, mouse
stężenie
0.5 mg - 1 mg/mL
metody
immunohistochemistry: suitable
western blot: suitable
numer dostępu NCBI
numer dostępu UniProt
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... DCX(1641)
Immunogen
Synthetic peptide directed towards the C terminal region of human DCX
Działania biochem./fizjol.
In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. DCX is a cytoplasmic protein which appears to direct neuronal migration by regulating the organization and stability of microtubules. The protein contains two doublecortin domains, which bind microtubules. In addition, DCX interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase, and this interaction is important to proper microtubule function in the developing cortex.In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. The protein encoded by this gene is a cytoplasmic protein which appears to direct neuronal migration by regulating the organization and stability of microtubules. The encoded protein contains two doublecortin domains, which bind microtubules. In addition, the encoded protein interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase, and this interaction is important to proper microtubule function in the developing cortex. Mutations in this gene are a cause of X-linked lissencephaly. Multiple transcript variants encoding at least three different isoforms have been found for this gene.
Sekwencja
Synthetic peptide located within the following region: PEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRR
Postać fizyczna
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Narzędzie selektora produktów.
polecane
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 3
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Certyfikaty analizy (CoA)
Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Klienci oglądali również te produkty
Lubica Kubikova et al.
Scientific reports, 4, 6590-6590 (2014-10-14)
A pallial-basal-ganglia-thalamic-pallial loop in songbirds is involved in vocal motor learning. Damage to its basal ganglia part, Area X, in adult zebra finches has been noted to have no strong effects on song and its function is unclear. Here we
Kristina Lukacova et al.
Biology, 11(3) (2022-03-27)
The striatal region Area X plays an important role during song learning, sequencing, and variability in songbirds. A previous study revealed that neurotoxic damage within Area X results in micro and macrostructural changes across the entire brain, including the downstream
Justina Polomova et al.
Proceedings. Biological sciences, 286(1895), 20182872-20182872 (2019-04-10)
Neurogenesis takes part in the adult songbird brain and new neurons are integrated into the forebrain including defined areas involved in the control of song learning and production. It has been suggested that the new neurons in the song system
Xun Chen et al.
Molecules and cells, 43(6), 517-529 (2020-05-22)
Carboxyl-terminal binding proteins (CtBPs) are transcription regulators that control gene expression in multiple cellular processes. Our recent findings indicated that overexpression of CtBP2 caused the repression of multiple bone development and differentiation genes, resulting in atrophic nonunion. Therefore, disrupting the
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej