Przejdź do zawartości
Merck

AV31500

Sigma-Aldrich

Anti-TCFL5 antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-Transcription factor-like 5 (basic helix-loop-helix)

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

53 kDa

reaktywność gatunkowa

human

stężenie

0.5 mg - 1 mg/mL

metody

immunohistochemistry: suitable
western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... TCFL5(10732)

Opis ogólny

TCFL5 is a basic helix-loop-helix (bHLH) protein that is expressed in primary spermatocytes. Studies in mice have revealed that Tcfl5 associated with the Calmegin gene promoter during spermatogenesis.
Rabbit Anti-TCFL5 antibody recognizes mouse and human TCFL5.

Immunogen

Synthetic peptide directed towards the middle region of human TCFL5

Zastosowanie

Rabbit Anti-TCFL5 antibody can be used for western blot assays at a concentration of 2.0μg/ml. The antibody product can also be used for IHC applications (4-8μg/ml, using paraffin-embedded tissues).

Działania biochem./fizjol.

TCFL5 is a new bHLH transcription factor that negatively regulates upstream transcription factor-dependent transcription.

Sekwencja

Synthetic peptide located within the following region: TLIRHPSELMNVPLQQQNKCTALVKNKTAATTTALQFTYPLFTTNACSTS

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Not finding the right product?  

Try our Narzędzie selektora produktów.

Kod klasy składowania

12 - Non Combustible Liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

O Maruyama et al.
Cytogenetics and cell genetics, 82(1-2), 41-45 (1998-10-09)
We have isolated a novel human gene that is expressed specifically in primary spermatocytes in the testis. The cDNA contains an open reading frame of 1356 bp, encoding a 452-amino-acid protein that includes a basic Helix-Loop-Helix (bHLH) motif. The gene
Michel Siep et al.
Nucleic acids research, 32(21), 6425-6436 (2004-12-09)
In mouse spermatogenesis, differentiating germ line cells initiate expression of specific genes at subsequent developmental steps. The Calmegin (Clgn) gene is first expressed in meiotic prophase, in primary spermatocytes, and encodes a protein that acts as a chaperone. To identify

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej