SAB2108685

Anti-KRAS Antibody

rabbit polyclonal

• 동의어(들): Anti- K-RAS2A, Anti- K-RAS2B, Anti- K-RAS4A, Anti- K-RAS4B, Anti-C-K-RAS
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 제품명: Anti-KRAS, affinity isolated antibody
• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 22 kDa
• 종 반응성: mouse, horse, rabbit, guinea pig, rat, yeast, dog, bovine, human
• 농도: 0.5-1 mg/mL
• 기술: immunoblotting: suitable
• 수납 번호(accession number): NM_033360
• UniProt 수납 번호: P01111
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... KRAS(3845)

설명

일반 설명

KRAS is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma.

면역원

Synthetic peptide directed towards the N terminal region of human KRAS

생화학적/생리학적 작용

KRAS is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma.

서열

Synthetic peptide located within the following region: TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable