We have not conducted experiments to determine whether Product No. SAB1404011, Monoclonal Anti-KRAS antibody, clone 4F3, will react with Human NRAS (UniProt P01111) and Human HRAS (UniProt P01112). However, based on the alignment data, there is a high probability of recognition, though we cannot guarantee it. In the comparison, the similarity between Human HRAS (UniProt P01112) and SAB1404011 KRAS monoclonal antibody, clone 4F3 is very high (96%), suggesting theoretical recognition. Similarly, the similarity between Human NRAS (UniProt P01111) and SAB1404011 KRAS monoclonal antibody, clone 4F3 is also very high (95%), indicating theoretical recognition.
₩930,349
구입 가능 여부는 고객센터에 문의하십시오.
추천 제품
제품명
Monoclonal Anti-KRAS antibody produced in mouse, clone 4F3, purified immunoglobulin, buffered aqueous solution
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
4F3, monoclonal
양식
buffered aqueous solution
분자량
antigen ~38.21 kDa
종 반응성
human
기술
capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
NCBI 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... KRAS(3845)
일반 설명
This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. (provided by RefSeq)
c-K-Ras or KRAS (Kirsten rat sarcoma-2 virus oncogene) is a small GTP-binding protein. The gene encoding it is localized on human chromosome 12p12.1. KRAS has two splice variants, that is, KRASA and KRASB (KRAS proto-oncogenes). Expression of KRASA is restricted to specific tissues whereas KRASB is ubiquitously expressed.
면역원
KRAS (NP_004976, 16 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTV
Sequence
KSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTV
애플리케이션
Monoclonal Anti-KRAS antibody produced in mouse has been used in Western Blotting.[1]
생화학적/생리학적 작용
KRAS (Kirsten rat sarcoma-2 virus oncogene) mutation has been associated with early rectal cancer and colorectal cancer. The protein has a role in signaling pathways.
KRAS (kirsten rat sarcoma-2 virus oncogene) upon binding to a cell surface receptor, including EGFR functions as a self-inactivating signal transducer by cycling from GDP- to GTP-bound states. Mutation in the gene leads to poor prognosis of early rectal cancer.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
David M Briere et al.
Molecular cancer therapeutics, 20(6), 975-985 (2021-03-17)
KRASG12C inhibitors, including MRTX849, are promising treatment options for KRAS-mutant non-small cell lung cancer (NSCLC). PD-1 inhibitors are approved in NSCLC; however, strategies to enhance checkpoint inhibitor therapy (CIT) are needed. KRASG12C mutations are smoking-associated transversion mutations associated with high
Prognostic value of KRAS codon 13 gene mutation for overall survival in colorectal cancer
Kwak MS, et al.
Medicine, 96(35) (2017)
KRAS G12C Drug Development: Discrimination between Switch II Pocket Configurations Using Hydrogen/Deuterium-Exchange Mass Spectrometry
Lu J, et al.
Structure, 25(9), 1442-1448 (2017)
The prognostic value of KRAS mutation by cell-free DNA in cancer patients: a systematic review and meta-analysis.
Zhuang R, et al.
PLoS ONE, 12(8), e0182562-e0182562 (2017)
Mei Zeng et al.
Cell chemical biology, 27(1), 19-31 (2019-12-31)
KRAS is the most frequently mutated oncogene found in pancreatic, colorectal, and lung cancers. Although it has been challenging to identify targeted therapies for cancers harboring KRAS mutations, KRASG12C can be targeted by small-molecule inhibitors that form covalent bonds with cysteine
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
