Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

WH0386618M4

Sigma-Aldrich

Monoclonal Anti-KCTD4 antibody produced in mouse

clone 2C8, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-bA321C24.3, Anti-potassium channel tetramerisation domain containing 4

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μG
489,00 €

489,00 €

Per informazioni sulla disponibilità, contatta il Servizio Clienti.
Tutte le immagini(2)

Scegli un formato

Cambia visualizzazione
100 μG
489,00 €

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

489,00 €

Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

mouse

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

2C8, monoclonal

Stato

buffered aqueous solution

Reattività contro le specie

human

tecniche

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2bκ

N° accesso Genebanck

BC018063

N° accesso UniProt

Q8WVF5

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... KCTD4(386618)

Descrizione generale

Potassium channel tetramerization domain containing 4 (KCTD4) is suggested to be a subunit of an ion channel and the gene encoding it is localized on human chromosome 13.

Immunogeno

KCTD4 (AAH18063, 1 a.a. ~ 259 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIRFKYFIKSENGTRLVLKEDNTFVCTLETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK

Azioni biochim/fisiol

Potassium channel tetramerization domain containing 4 (KCTD4) has been shown to be downregulated in chondrosis.

Caratteristiche e vantaggi

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

nwg

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number
07177-2C8

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Cerca un COA

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

John J Orczyk et al.
The Journal of comparative neurology, 524(1), 152-159 (2015-06-26)
The effects of infraorbital nerve (ION) transection on gene expression in the adult male rat barrel cortex were investigated using RNA sequencing. After a 24-hour survival duration, 98 genes were differentially regulated by ION transection. Differentially expressed genes suggest changes
Muhammad Farooq Rai et al.
Arthritis and rheumatism, 65(8), 2090-2101 (2013-05-10)
Meniscus tears are associated with a heightened risk of osteoarthritis. This study aimed to advance our understanding of the metabolic state of injured human meniscus at the time of arthroscopic partial meniscectomy through transcriptome-wide analysis of gene expression in relation
Brooke L Fridley et al.
BMC medical genomics, 7, 21-21 (2014-04-30)
Genome-wide interrogation of DNA methylation (DNAm) in blood-derived leukocytes has become feasible with the advent of CpG genotyping arrays. In epithelial ovarian cancer (EOC), one report found substantial DNAm differences between cases and controls; however, many of these disease-associated CpGs

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.