WH0007038M1

Monoclonal Anti-TG antibody produced in mouse

clone 1G3, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-AITD3, Anti-thyroglobulin
• Numero MDL: MFCD00164673
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 1G3, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• N° accesso Genebanck: NM_003235
• N° accesso UniProt: P01266
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... TG(7038)

Descrizione

Descrizione generale

Thyroglobulin (TG) is a 660 kDa homodimeric glycoprotein, secreted by endoplasmic reticulum. The gene is located on human chromosome 8q24.22. It is majorly expressed in thyroid gland.

Immunogeno

TG (NP_003226, 2659 a.a. ~ 2768 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK

Azioni biochim/fisiol

Thyroglobulin (TG) regulates iodide storage and synthesis of thyroid hormones, thyroxine (T₄) and triiodothyronine (T₃). Mutations in TG is associated with goiter and congenital hypothyroidism. Polymorphisms in this gene is linked to autoimmune thyroid diseases (AITD) like, Graves′ disease and Hashimoto thyroiditis.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)