WH0004647M1

Monoclonal Anti-MYO7A antibody produced in mouse

clone 1D3, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-DFNA11, Anti-DFNB2, Anti-MYU7A, Anti-NSRD2, Anti-USH1B, Anti-myosin VIIA
• Numero MDL: MFCD02263784
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 1D3, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable
• Isotipo: IgG1κ
• N° accesso Genebanck: NM_000260
• N° accesso UniProt: Q13402
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... MYO7A(4647)

Descrizione

Descrizione generale

MYO7A (myosin VIIA) or HM7A consists of 5 isoleucine-glutamine (IQ) motifs. It is present in retinal epithelial cells. It also interacts with other USH1 (Usher syndrome type 1B) gene products like harmonin and sans. This gene is located on human chromosome 11q13.

Immunogeno

MYO7A (NP_000251, 2118 a.a. ~ 2213 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KQTTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRS

Azioni biochim/fisiol

MYO7A (myosin VIIA) or HM7A is involved in anchoring and holding membrane-bound elements to the actin core of the stereocilium. It acts as a transporter. This protein may participate in the tethering of melanosomes at the root of actin bundles. HM7A is responsible for Usher syndrome type 1B. In mice and humans, alteration in Myo7a causes hereditary deafness.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)