Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

MSST0010

Sigma-Aldrich

SILuLite MAPK1 Mitogen Activated Protein Kinase 1 human

recombinant, expressed in HEK 293 cells, MS Protein Standard

Sinonimo/i:

Extracellular signal-regulated kinase 2 (Erk2), Mitogen-activated protein kinase 1 (MAPK1)

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

50 μG
708,00 €

708,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Richiedi un ordine bulk

Scegli un formato

Cambia visualizzazione
50 μG
708,00 €

About This Item

Codice UNSPSC:
23201100
NACRES:
NA.12

708,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Richiedi un ordine bulk

Ricombinante

expressed in HEK 293 cells

Livello qualitativo

Tag

His tagged

Saggio

≥95% (SDS-PAGE)

Stato

liquid

PM

43.8 kDa

Compatibilità

suitable for mass spectrometry (internal calibrator)

N° accesso UniProt

Malattie correlate

cancer

Temperatura di conservazione

−20°C

Descrizione generale

SILuLite MAPK1 is a recombinant human MAPK1 expressed in human 293 cells. It is a monomer of 380 amino acids (including polyhistidine and flag tags), with an apparent molecular weight of 44 kDa. SILuLite MAPK1 is designed to be used as an internal standard for bioanalysis of MAPK1 in mass-spectrometry.

Azioni biochim/fisiol

MAPK1 is a cytoplasmic protein that following activation is capable of translocating to the nucleus where it phosphorylates and regulates nuclear proteins (e.g., Elk-1, c-Myc, c-Jun, c-Fos, and C/EBP β). It is a protein serine/threonine kinase that is a member of the extracellular signal-regulated kinases (ERKs) which are activated in response to numerous growth factors and cytokines. Aberrations in the RAS-MAPK complex (of which MAPK1 is a downstream effector) are implicated in several human cancers, and this renders the pathway an attractive therapeutic target.

Sequenza

MDYKDDDDKGHHHHHHHHGGQAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Stato fisico

Supplied as a 0.1 mg/mL solution of 20mM sodium phosphate, pH 8.0, 1M NaCl.

Note legali

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].
SILu is a trademark of Sigma-Aldrich Co. LLC

Pittogrammi

Exclamation mark

Avvertenze

Warning

Indicazioni di pericolo

Classi di pericolo

Eye Irrit. 2

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.