MSST0006

SILu^™Lite VEGFA Vascular endothelial growth factor A human

recombinant, expressed in HEK 293 cells, MS Protein Standard

• Sinonimo/i: SILuLite Vascular endothelial growth factor A
• Codice UNSPSC: 23201100
• NACRES: NA.12

Proprietà

• Origine biologica: human
• Livello qualitativo: 200
• Ricombinante: expressed in HEK 293 cells
• Saggio: ≥98% (SDS-PAGE)
• Stato: lyophilized powder
• tecniche: mass spectrometry (MS): suitable
• N° accesso UniProt: P15692
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... VEGFA(7422)

Descrizione

Descrizione generale

SILu^™ Lite VEGF165 is a recombinant glycosylated human protein expressed in human 293 cells. It is a homodimer with an apparent molecular mass of 45 kDa.


Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Azioni biochim/fisiol

VEGF165 belongs to the PDGF/VEGF growth factor family characterized by the presence of eight conserved cysteine residues and a cystine knot structure.¹ VEGF is secreted by the majority of tumor cells and initiates angiogenesis by activating endothelial cells of existing blood vessels and promoting their migration.²
VEGF has also been implicated in correlation with poor prognosis in breast cancer.² In addition, VEGF is released in rheumatoid arthritis in response to TNF-α, increasing endothelial permeability and stimulating angiogenesis (formation of capillaries)^3,4

Sequenza

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGC

Stato fisico

Supplied as a lyophilized powder containing phosphate buffered saline

Note legali

SILu is a trademark of Sigma-Aldrich Co. LLC

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 11 - Combustible Solids
• Classe di pericolosità dell'acqua (WGK): WGK 2
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable