Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV46013

Sigma-Aldrich

Anti-PRIM1 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-MGC12308, Anti-Primase, polypeptide 1, 49 kDa, Anti-p49

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

50 kDa

Reattività contro le specie

rabbit, rat, guinea pig, bovine, human, horse, mouse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PRIM1(5557)

Immunogeno

Synthetic peptide directed towards the N terminal region of human PRIM1

Applicazioni

Anti-PRIM1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.

Azioni biochim/fisiol

Human DNA primase 1 (PRIM1) is a pivotal enzyme component of complex chromosomal replication apparatus. It functions in synchronization with DNA polymerase alpha during replication in eukaryotic cells. DNA primase facilitates the synthesis of small RNA primers that initiate synthesis of the lagging DNA strand.

Sequenza

Synthetic peptide located within the following region: SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

F Stadlbauer et al.
European journal of biochemistry, 222(3), 781-793 (1994-06-15)
DNA-polymerase-alpha--primase complex contains four subunits, p180, p68, p58, and p48, and comprises a minimum of two enzymic functions. We have cloned cDNAs encoding subunits of DNA-polymerase-alpha--primase from human and mouse. Sequence comparisons showed high amino acid conservation among the mammalian
Mairi L Kilkenny et al.
The Journal of biological chemistry, 287(28), 23740-23747 (2012-05-18)
The DNA polymerase α-primase complex forms an essential part of the eukaryotic replisome. The catalytic subunits of primase and pol α synthesize composite RNA-DNA primers that initiate the leading and lagging DNA strands at replication forks. The physical basis and

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.