Synthetic peptide directed towards the middle region of human CPS1
Applicazioni
Anti-CPS1 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.
Azioni biochim/fisiol
Carbamoyl-phosphate synthase 1 (CPS1) is a liver specific, mitochondrial enzyme that catalyzes the synthesis of carbamoyl phosphate from ammonia and bicarbonate. It is involved in the removal of ammonia in the urea cycle and is important for the detoxification of excess ammonia. The expression of CPS1 is reportedly downregulated due to DNA methylation in human hepatocellular carcinoma.
Sequenza
Synthetic peptide located within the following region: YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The American journal of pathology, 178(2), 652-661 (2011-02-02)
Carbamoyl phosphate synthetase 1 (CPS1) is a liver-specific, intramitochondrial, rate-limiting enzyme in the urea cycle. A previous study showed that CPS1 is the antigen for hepatocyte paraffin 1 antibody, a commonly used antibody in surgical pathology practice; and CPS1 expression
Biochemical and biophysical research communications, 420(1), 54-60 (2012-03-10)
Mitochondria are the primary locus for the generation of reactive nitrogen species including peroxynitrite and subsequent protein tyrosine nitration. Protein tyrosine nitration may have important functional and biological consequences such as alteration of enzyme catalytic activity. In the present study
Domande
Recensioni
★★★★★ Nessuna valutazione
Filtri attivi
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
