374090
Anti-Heme Oxygenase-1 (1-30) Rabbit pAb
liquid, Calbiochem®
Sinonimo/i:
Anti-HO-1, Anti-Hsp32
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Forma dell’anticorpo
purified antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Forma fisica
liquid
contiene
≤0.1% sodium azide as preservative
Reattività contro le specie
human, hamster, monkey, mouse, rat, canine
Produttore/marchio commerciale
Calbiochem®
Condizioni di stoccaggio
OK to freeze
avoid repeated freeze/thaw cycles
Isotipo
IgG
Condizioni di spedizione
ambient
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... HMOX1(3162)
Descrizione generale
Anti-Heme Oxygenase-1 (1-30), rabbit polyclonal, recognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2. It is validated for use in Western blotting and immunoprecipitation.
Protein A purified rabbit polyclonal antibody. Recognizes the ~32 kDa HO-1 protein.
Recognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2.
Immunogeno
Human
a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
Applicazioni
Immunoblotting (1:1000, chemiluminescence)
Immunoprecipitation (1:100)
Immunoprecipitation (1:100)
Attenzione
Toxicity: Standard Handling (A)
Stato fisico
In PBS, 50% glycerol, pH 7.2.
Ricostituzione
Following initial thaw, aliquot and freeze (-20°C).
Altre note
Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
Maines, M.D. 1988 FASEB J.2, 2557.
Kutty, R.K., et al. 1994. J. Cell Physiol.159, 371.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.
Kutty, R.K., et al. 1994. J. Cell Physiol.159, 371.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.
Note legali
CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany
Not finding the right product?
Try our Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 1
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Jin-Woo Jeong et al.
Foods (Basel, Switzerland), 8(8) (2019-07-31)
Sea tangle (Laminaria japonica Aresch), a brown alga, has been used for many years as a functional food ingredient in the Asia-Pacific region. In the present study, we investigated the effects of fermented sea tangle extract (FST) on receptor activator
Da Hye Kwon et al.
International journal of molecular medicine, 41(1), 264-274 (2017-11-09)
Schisandrin A is a bioactive lignan occurring in the fruits of plants of the Schisandra genus that have traditionally been used in Korea for treating various inflammatory diseases. Although the anti-inflammatory and antioxidant effects of lignan analogues similar to schisandrin A have
Seon Yeong Ji et al.
Biomolecules & therapeutics, 29(6), 685-696 (2021-04-07)
In this study, we investigated the inhibitory effect of 5-aminolevulinic acid (ALA), a heme precursor, on inflammatory and oxidative stress activated by lipopolysaccharide (LPS) in RAW 264.7 macrophages by estimating nitric oxide (NO), prostaglandin E2 (PGE2), cytokines, and reactive oxygen
Yun-Ta Liu et al.
Nutrients, 12(2) (2020-02-23)
14-Deoxy-11,12-didehydroandrographolide (deAND), a diterpenoid in Andrographis paniculata (Burm. f.) Nees, acts as a bioactive phytonutrient that can treat many diseases. To investigate the protective effects of deAND on reducing fatty liver disease, male mice were fed a high-fat and high-cholesterol
Cheol Park et al.
Marine drugs, 17(4) (2019-04-25)
Phloroglucinol (PG) is a component of phlorotannins, which are abundant in marine brown alga species. Recent studies have shown that PG is beneficial in protecting cells from oxidative stress. In this study, we evaluated the protective efficacy of PG in
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.