219483

Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control

A scrambled caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58).

• Sinonimo/i: Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control, AP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK- WGI DKASFTTFTVTKYWF RY, AP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY
• Formula empirica (notazione di Hill): C₂₂₈H₃₃₅N₆₁O₄₉S
• Peso molecolare: 4746.54
• Codice UNSPSC: 12352200

Proprietà

• Livello qualitativo: 100
• Saggio: ≥95% (HPLC)
• Forma fisica: lyophilized solid
• Produttore/marchio commerciale: Calbiochem^®
• Condizioni di stoccaggio: OK to freeze; desiccated (hygroscopic); protect from light
• Colore: white
• Solubilità: DMSO: 2 mg/mL
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C

Descrizione

Descrizione generale

A scrambled caveolin-1 scaffolding domain peptide (C1-SD_82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58). Serves as an useful negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).

A scrambled caveolin-1 scaffolding domain peptide (C1-SD_82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58). Serves as an useful negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).

Azioni biochim/fisiol

Cell permeable: no

Primary Target
Negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).

Product does not compete with ATP.

Reversible: no

Confezionamento

Packaged under inert gas

Attenzione

Toxicity: Standard Handling (A)

Sequenza

H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Trp-Gly-Ile-Asp-Lys-Ala-Ser-Phe-Thr-Thr-Phe-Thr-Val-Thr-Lys-Tyr-Trp-Phe-Arg-Tyr-OH

Stato fisico

Supplied as a trifluoroacetate salt.

Ricostituzione

Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.

Altre note

Gratton, J.P., et al. 2003. Cancer Cell4, 31.
Sukumaran, S.K., et al. 2002. J. Biol. Chem.277, 50716.
Bucci, M., et al. 2000. Nat. Med.6, 1362.

Note legali

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany