WH0007704M1

Monoclonal Anti-ZBTB16 antibody produced in mouse

clone 3A7, purified immunoglobulin, buffered aqueous solution

• Szinonimák: Anti-PLZF, Anti-ZNF145, Anti-zinc finger and BTB domain containing 16
• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: ELISA (i); PLA; WB
• klón: 3A7, monoclonal
• faj reaktivitás: human
• citations: 1
• technika/technikák: indirect ELISA: suitable; proximity ligation assay: suitable; western blot: 1-5 μg/mL

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: 3A7, monoclonal
• Forma: buffered aqueous solution
• faj reaktivitás: human
• technika/technikák: indirect ELISA: suitable; proximity ligation assay: suitable; western blot: 1-5 μg/mL
• izotípus: IgG2aκ
• GenBank elérési szám: BC029812
• UniProt elérési szám: Q05516
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... ZBTB16(7704)

Leírás

Általános leírás

This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized. (provided by RefSeq)

Immunogén

ZBTB16 (AAH29812, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVEQHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Jogi információk

GenBank is a registered trademark of United States Department of Health and Human Services

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable
• Egyéni védőeszköz: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)