WH0002294M5

Monoclonal Anti-FOXF1 antibody produced in mouse

clone 3D1, purified immunoglobulin, buffered aqueous solution

• Szinonimák: Anti-FKHL5, Anti-FREAC1, Anti-MGC105125, Anti-forkhead box F1
• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: ELISA (i)
• klón: 3D1, monoclonal
• faj reaktivitás: human
• technika/technikák: indirect ELISA: suitable

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: 3D1, monoclonal
• Forma: buffered aqueous solution
• faj reaktivitás: human
• technika/technikák: indirect ELISA: suitable
• izotípus: IgG2aκ
• GenBank elérési szám: NM_001451
• UniProt elérési szám: Q12946
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... FOXF1(2294)

Leírás

Általános leírás

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the regulation of pulmonary genes as well as embryonic development. (provided by RefSeq)

Immunogén

FOXF1 (NP_001442, 251 a.a. ~ 353 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AALNSGASYIKQQPLSPCNPAANPLSGSLSTHSLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHSAGGGSYYHQQVTYQDIKPCV

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Jogi információk

GenBank is a registered trademark of United States Department of Health and Human Services

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable
• Egyéni védőeszköz: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)