WH0000545M1

Monoclonal Anti-ATR antibody produced in mouse

clone 3F2, purified immunoglobulin, buffered aqueous solution

• Szinonimák: Anti-FRP1, Anti-SCKL, Anti-SCKL1, Anti-ataxia telangiectasia and Rad3 related
• MDL-szám: MFCD03096632
• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: ELISA (i); IF; WB
• klón: 3F2, monoclonal
• faj reaktivitás: human
• technika/technikák: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: 3F2, monoclonal
• Forma: buffered aqueous solution
• faj reaktivitás: human
• technika/technikák: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotípus: IgG1κ
• GenBank elérési szám: NM_001184
• UniProt elérési szám: Q13535
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... ATR(545)

Leírás

Immunogén

ATR (NP_001175, 2545 a.a. ~ 2644 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM

Tulajdonságok és előnyök

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Jogi információk

GenBank is a registered trademark of United States Department of Health and Human Services

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable
• Egyéni védőeszköz: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)