SAB2108515

Anti-TWIST1

IgG fraction of antiserum

• Szinonimák: Anti- ACS3, Anti- BPES2, Anti- BPES3, Anti- CRS1, Anti-SCS
• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: IHC
• klón: polyclonal
• faj reaktivitás: bovine, mouse, rat, horse, pig, human
• citations: 1
• technika/technikák: immunoblotting: suitable; immunohistochemistry: suitable

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: IgG fraction of antiserum
• antitest terméktípus: primary antibodies
• klón: polyclonal
• Forma: buffered aqueous solution
• molekulatömeg: 21 kDa
• faj reaktivitás: bovine, mouse, rat, horse, pig, human
• koncentráció: 0.5-1 mg/mL
• technika/technikák: immunoblotting: suitable; immunohistochemistry: suitable
• elérési szám: NM_000474
• UniProt elérési szám: Q15672
• alkalmazás(ok): research pathology
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... TWIST1(7291)

Leírás

Immunogén

Synthetic peptide directed towards the C terminal region of human TWIST1

Biokémiai/fiziológiai hatások

Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation.TWIST1 is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue; in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome.

Szekvencia

Synthetic peptide located within the following region: DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVW

Fizikai forma

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 3
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable