SAB2106317

Anti-PTHLH antibody produced in rabbit

affinity isolated antibody

• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: IHC; WB
• klón: polyclonal
• faj reaktivitás: mouse, dog, bovine, guinea pig, goat, sheep, rabbit, human, rat
• technika/technikák: immunohistochemistry: suitable; western blot: suitable

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• Forma: buffered aqueous solution
• molekulatömeg: 16 kDa
• faj reaktivitás: mouse, dog, bovine, guinea pig, goat, sheep, rabbit, human, rat
• koncentráció: 0.5 mg - 1 mg/mL
• technika/technikák: immunohistochemistry: suitable; western blot: suitable
• NCBI elérési szám: NM_008970
• UniProt elérési szám: P22858
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... PTHLH(5744) ; mouse ... Pthlh(19227)

Leírás

Immunogén

Synthetic peptide directed towards the middle region of human PTHLH

Biokémiai/fiziológiai hatások

Pthlh is a neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. It regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is required for skeletal homeostasis. It promotes mammary mesenchyme differentiation and bud outgrowth by modulating mesenchymal cell responsiveness to BMPs. It upregulates BMPR1A expression in the mammary mesenchyme and this increases the sensitivity of these cells to BMPs and allows them to respond to BMP4 in a paracrine and/or autocrine fashion. BMP4 signaling in the mesenchyme, in turn, triggers epithelial outgrowth and augments MSX2 expression, which causes the mammary mesenchyme to inhibit hair follicle formation within the nipple sheath.

Szekvencia

Synthetic peptide located within the following region: EVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKK

Fizikai forma

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 3
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable