SAB2105749

Anti-ATXN3, (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Szinonimák: Anti-AT3, Anti-ATX3, Anti-JOS, Anti-MJD, Anti-MJD1
• UNSPSC kód: 12352203
• NACRES: NA.41
• klón: polyclonal
• application: WB
• faj reaktivitás: human, bovine, mouse, guinea pig, sheep, horse, dog, rat
• technika/technikák: western blot: suitable
• citations: 1

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• Forma: buffered aqueous solution
• molekulatömeg: 41 kDa
• faj reaktivitás: human, bovine, mouse, guinea pig, sheep, horse, dog, rat
• koncentráció: 0.5 mg - 1 mg/mL
• technika/technikák: western blot: suitable
• NCBI elérési szám: NM_004993
• UniProt elérési szám: P54252
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• Géninformáció: human ... ATXN3(4287)

Leírás

Immunogén

Synthetic peptide directed towards the N terminal region of human ATXN3

Biokémiai/fiziológiai hatások

Machado-Joseph disease, also known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein encoded by this gene contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Szekvencia

Synthetic peptide located within the following region: SIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNAL

Fizikai forma

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 3
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable